Certikin Spafresh 1 Litre Surface Cleaner – Pack Of 6 (SFSUC/6)

Certikin Spafresh 1 Litre Surface Cleaner is a top-of-the-line cleaning solution designed specifically for spas and hot tubs. This pack contains 6 bottles of the powerful surface cleaner, ensuring you have an ample supply to keep your spa pristine and inviting with minimal effort.

Keeping your spa clean is not just about aesthetics; it is essential for maintaining a safe and hygienic environment for you and your guests to enjoy. The Spafresh Surface Cleaner is formulated to effectively remove dirt, oils, and other contaminants that can accumulate on the surface of your spa, ensuring that your water stays crystal clear and free from impurities.

One of the standout features of the Certikin Spafresh Surface Cleaner is its superior cleaning power. With just a small amount of this concentrated formula, you can achieve remarkable results, effortlessly eliminating grime and residue from your spa’s surfaces. Whether you are dealing with stubborn stains or routine maintenance, this cleaner is up to the task.

Moreover, the Spafresh Surface Cleaner is specially designed to be gentle on spa surfaces while still delivering a deep clean. This means you can trust that your spa’s delicate materials will not be damaged during the cleaning process, allowing you to maintain the beauty and integrity of your investment for years to come.

Convenience is another key benefit of using the Certikin Spafresh Surface Cleaner. The 1-litre bottles are easy to handle and store, ensuring that you always have a supply of this essential cleaning solution on hand. Whether you are a spa owner or a professional in the industry, having a reliable and effective cleaner like Spafresh at your disposal can streamline your maintenance routine and enhance the overall experience for you and your guests.

Regular use of the Spafresh Surface Cleaner can also help extend the life of your spa equipment by preventing the buildup of grime and residue that can lead to corrosion or other damage. By incorporating this cleaner into your maintenance regimen, you are not only preserving the appearance of your spa but also safeguarding its functionality for years to come.

For added convenience and peace of mind, the Certikin Spafresh Surface Cleaner is part of a comprehensive range of spa maintenance products. By exploring the Spa Fresh brochure and accompanying documentation, you can discover a complete suite of solutions designed to support the upkeep and longevity of your spa, from water balancing products to specialty treatments.

When it comes to maintaining your spa, quality matters. Trust Certikin Spafresh 1 Litre Surface Cleaner to deliver exceptional results, ease of use, and peace of mind, ensuring that your spa remains a haven of relaxation and enjoyment for you and your guests. Invest in the best for your spa with Certikin Spafresh.

Manufacturers description:

Certikin Spafresh 1 Litre Surface Cleaner – Pack Of 6

The Spafresh range contains all the chemicals necessary for maintaining and sanitising a spa or hot tub. Take a look at the Spa Fresh brochure for more details.

Product documentation:

chem_br_spafresh_guide-573.pdf

350msdsspafreshalkalinityincreaser201013-905.pdf

351msdsspafreshhardnessincreaser151113-906.pdf

352msdsspafreshsurfacecleaner201013-907.pdf

355msdsspafreshphreducer201013-908.pdf

356msdsspafreshphplus201013-909.pdf

357msdsspafreshmultifunctionminichlorinetablets151113-910.pdf

360msdsspafreshbrominetablets-un3085121113-911.pdf

363msdsspafreshsystemflush040213-912.pdf

365msdsspafreshfoamfree070114-913.pdf

Stock note: In an effort to provide the quickest possible delivery for our customers we may ship an alternative premium branded product if stocks are low. These brands will only be Blue Horizons, Deep Blue Pro, Relax or Swim Fresh, all established for a long time in the water treatment industry.