Certikin Spafresh 1Kg Bromine Tablets – Pack Of 6 (SFBT/6)

20 people are viewing this product
Sales in the last 24 hours: 19

£290.97 £232.78

  • Bromine Tablets for Sanitization: Spafresh 1Kg Bromine Tablets ensure effective sanitization to keep your spa or hot tub clean and safe.
  • Convenient Pack of 6: This pack offers a sufficient supply of bromine tablets for consistent maintenance and long-term use.
  • Spa Fresh Range Inclusion: Part of the Spa Fresh range, these tablets are designed for comprehensive spa care and maintenance.
  • Easy Application: Simply add the tablets to your spa water for hassle-free sanitization and water treatment.
  • Enhanced Spa Experience: Experience crystal-clear water and a refreshing spa environment with these high-quality bromine tablets.
  • Chemical Balance Maintenance: Helps in maintaining the right chemical balance in your spa water for optimal performance and safety.
  • Minimal Residue: Leaves minimal residue, ensuring a clean and clear spa without any unwanted buildup.
  • Long-Lasting Effectiveness: Provides long-lasting sanitization, reducing the frequency of chemical application and maintenance.
  • Professional Spa Care: Trusted by professionals, these tablets offer reliable spa care for a luxurious and safe spa experience.
  • Comprehensive Documentation: Access detailed product documentation for effective usage and maintenance guidance.
  • Please check the stock note in the description for our quickest delivery times.

In stock

Title Range Discount
Sale / Bulk discount 1 20%
Sale / Bulk discount 2 23%
Sale / Bulk discount 3 - 4 25%
Sale / Bulk discount 5 - 7 26%
Sale / Bulk discount 8 - 11 28%
Sale / Bulk discount 12 + 30%
SKU CTKSFBT/6 Categories , Brand:

Welcome to the world of spa maintenance made easy with Certikin Spafresh 1Kg Bromine Tablets. This pack of 6 tablets is your ticket to a clean, sanitized, and enjoyable spa or hot tub experience. Say goodbye to the hassle of manual sanitizing and hello to the convenience of these powerful bromine tablets.

Why choose Certikin Spafresh Bromine Tablets, you ask? Well, let’s dive into the details. These tablets are specially formulated to keep your spa water crystal clear and free from harmful bacteria. With Certikin’s expertise in pool and spa care, you can trust that these tablets are designed to deliver top-notch performance.

One of the key advantages of bromine is its ability to remain effective at higher temperatures, making it an ideal choice for hot tubs and spas. Unlike chlorine, bromine doesn’t produce strong odors or irritate the skin and eyes, ensuring a more pleasant spa experience for you and your guests.

Each 1Kg pack contains 6 tablets, providing you with a sufficient supply to keep your spa water balanced and sanitized. Simply follow the recommended dosage based on your spa size and usage frequency, and let the bromine tablets do the hard work for you.

But the benefits don’t stop there. Certikin Spafresh Bromine Tablets also help to prevent the growth of algae, ensuring that your spa water remains inviting and clear. Say goodbye to green water and hello to a spa that’s always ready for relaxation.

With the Spafresh range, maintaining your spa has never been easier. From alkalinity increasers to surface cleaners, Certikin offers a complete solution for all your spa care needs. Check out the product documentation links provided to learn more about the comprehensive range of Spafresh products available.

Don’t let water chemistry woes dampen your spa experience. Trust Certikin Spafresh Bromine Tablets to keep your spa water pristine and inviting. Whether you’re a seasoned spa enthusiast or a newcomer to the world of hot tub relaxation, these tablets are your go-to solution for hassle-free spa maintenance.

Invest in the quality and reliability of Certikin products and enjoy a spa experience like never before. Say hello to sparkling clean water, a refreshing spa environment, and peace of mind knowing that your spa is well taken care of. Elevate your spa experience with Certikin Spafresh Bromine Tablets today.

Manufacturers description:

Certikin Spafresh 1Kg Bromine Tablets – Pack Of 6

The Spafresh range contains all the chemicals necessary for maintaining and sanitising a spa or hot tub. Take a look at the Spa Fresh brochure for more details.

Product documentation:

chem_br_spafresh_guide-573.pdf

350msdsspafreshalkalinityincreaser201013-905.pdf

351msdsspafreshhardnessincreaser151113-906.pdf

352msdsspafreshsurfacecleaner201013-907.pdf

355msdsspafreshphreducer201013-908.pdf

356msdsspafreshphplus201013-909.pdf

357msdsspafreshmultifunctionminichlorinetablets151113-910.pdf

360msdsspafreshbrominetablets-un3085121113-911.pdf

363msdsspafreshsystemflush040213-912.pdf

365msdsspafreshfoamfree070114-913.pdf

Stock note: In an effort to provide the quickest possible delivery for our customers we may ship an alternative premium branded product if stocks are low. These brands will only be Blue Horizons, Deep Blue Pro, Relax or Swim Fresh, all established for a long time in the water treatment industry.

Weight 6 kg
EAN

5060228496141

Form

Tablets

Group

Spa Chemicals & Accessories

Manufacturer Part No

SFBT/6

Brand

Certikin

GPSR Responsible Operator

Certikin International Ltd

GPSR Address Line 1

Unit 9 Witan Park

GPSR City

Witney

GPSR Post Code

OX28 4FJ

GPSR Country

UK

GPSR Email

[email protected]

GPSR Manufacturer Name

Certikin International Ltd

GPSR Warn Safety Info 01

Harmful if swallowed.

GPSR Warn Safety Info 02

Causes serious eye irritation.

GPSR Warn Safety Info 03

Very toxic to aquatic life with long lasting effects.

GPSR Warn Safety Info 04

May cause respiratory irritation.

11 reviews for Certikin Spafresh 1Kg Bromine Tablets – Pack Of 6 (SFBT/6)

  1. jo

    arrived on time a nice product

  2. graeme lamb

    The crystals were great and did exactly it says they would do . Thank you

  3. Danny Hayhow

    It does the job

  4. Ian T.

    Great product

  5. Marcy N

    top

  6. Marcy N

    top

  7. rachael denham

    Very good product

  8. mr s allen

    great value

  9. Jane Clarke

    Good value

  10. Vicki

    Thank you

Add a review

[related_blog_posts]
You were not leaving your cart just like that, right?

You were not leaving your trolley like that, were you?

Please enter your details below to save your trolley for later. If you have any questions please leave your email address and we will provide a swift response.

Certikin Spafresh 1Kg Bromine Tablets – Pack Of 6 (SFBT/6)

In stock

Title Range Discount
Sale / Bulk discount 1 20%
Sale / Bulk discount 2 23%
Sale / Bulk discount 3 - 4 25%
Sale / Bulk discount 5 - 7 26%
Sale / Bulk discount 8 - 11 28%
Sale / Bulk discount 12 + 30%